Skip to product information
1 of 1

14-3-3 beta, Cynomolgus

14-3-3 beta, Cynomolgus

Size

SKU:QM-0205392-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

  • Molecular Formula

    101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

  • Smiles

    MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205392-01
5 µgQM-0205392-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0205392-02
10 µgQM-0205392-02
£104.88/ea
£0.00
£104.88/ea £0.00
50 µgQM-0205392-03
50 µgQM-0205392-03
£293.00/ea
£0.00
£293.00/ea £0.00
100 µgQM-0205392-04
100 µgQM-0205392-04
£437.58/ea
£0.00
£437.58/ea £0.00
500 µgQM-0205392-05
500 µgQM-0205392-05
£1,134.99/ea
£0.00
£1,134.99/ea £0.00
1 mgQM-0205392-06
1 mgQM-0205392-06
£1,893.15/ea
£0.00
£1,893.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

14-3-3 beta, Cynomolgus

14-3-3 beta, Cynomolgus is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.