Name: 15-PGDH/HPGD, Human (C-His)
Brand: QuantiMol
SKU: QM-0169073-01
Price: 111.63 GBP
Availability: InStock

Product Details

Description
15-PGDH/HPGD, a short-chain nonmetalloenzyme alcohol dehydrogenase, is crucial for prostaglandin metabolism, influencing various physiological and cellular processes like inflammation. Mutations lead to hypertrophic osteoarthropathy. Biased expression in urinary bladder (RPKM 176.8) and stomach (RPKM 67.9), among other tissues. Multiple isoforms arise from various transcript variants. 15-PGDH/HPGD Protein, Human (C-His) is the recombinant human-derived 15-PGDH/HPGD, expressed by E. coli, with C-6*His labeled tag. The total length of 15-PGDH/HPGD Protein, Human (C-His) is 266 a.a..
Molecular Formula
3248 (Gene_ID) NP_000851.2 (M1-Q266) (Accession)
Smiles
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169073-01	5 µgQM-0169073-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

10 µgQM-0169073-02	10 µgQM-0169073-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0169073-03	50 µgQM-0169073-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0169073-04	100 µgQM-0169073-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

500 µgQM-0169073-05	500 µgQM-0169073-05 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

1 mgQM-0169073-06	1 mgQM-0169073-06 £1,986.71/ea	£0.00	Quantity	£1,986.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

15-PGDH/HPGD, Human (C-His)

15-PGDH/HPGD, Human (C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.