Skip to product information
1 of 1

4-1BB/TNFRSF9, Human

4-1BB/TNFRSF9, Human

Size

SKU:QM-0191077-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Human 4-1BB protein is a surface glycoprotein with a transmembrane domain (187-213 a.a.) . 4-1BB/TNFRSF9 Protein, Human is the extracellular part (E19-S184) of 4-1BB protein, produced by E. coli with tag free.

  • Molecular Formula

    3604 (Gene_ID) Q07011 (E19-S184) (Accession)

  • Smiles

    ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0191077-01
10 µgQM-0191077-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0191077-02
50 µgQM-0191077-02
£591.89/ea
£0.00
£591.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

4-1BB/TNFRSF9, Human

4-1BB/TNFRSF9, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.