Skip to product information
1 of 1

4-1BBL/TNFSF9, Human

4-1BBL/TNFSF9, Human

Size

SKU:QM-0181079-01

£188.51 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD) [1]. 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses[3]. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL/TNFSF9 Protein, Human is a recombinant protein consisting of 184 amino acids (R71-E254) and is produced in E. coli.

  • Molecular Formula

    8744 (Gene_ID) P41273 (R71-E254) (Accession)

  • Smiles

    REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

  • Purity

    95.83

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0181079-01
10 µgQM-0181079-01
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0181079-02
50 µgQM-0181079-02
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

4-1BBL/TNFSF9, Human

4-1BBL/TNFSF9, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.