Skip to product information
1 of 1

4-1BBL/TNFSF9, Mouse (HEK293, His)

4-1BBL/TNFSF9, Mouse (HEK293, His)

Size

SKU:QM-0203785-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD) [1]. 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses[3]. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL/TNFSF9 Protein, Mouse (HEK293, His) is a recombinant protein with a N-Terminal His label, It consists of 206 amino acids (R104-E309) and is produced in HEK293 cells.

  • Molecular Formula

    21950 (Gene_ID) P41274 (R104-E309) (Accession)

  • Smiles

    HHHHHHHHHHRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203785-01
2 µgQM-0203785-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0203785-02
10 µgQM-0203785-02
£112.75/ea
£0.00
£112.75/ea £0.00
50 µgQM-0203785-03
50 µgQM-0203785-03
£316.08/ea
£0.00
£316.08/ea £0.00
100 µgQM-0203785-04
100 µgQM-0203785-04
£492.26/ea
£0.00
£492.26/ea £0.00
500 µgQM-0203785-05
500 µgQM-0203785-05
£1,156.87/ea
£0.00
£1,156.87/ea £0.00
1 mgQM-0203785-06
1 mgQM-0203785-06
£1,710.90/ea
£0.00
£1,710.90/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

4-1BBL/TNFSF9, Mouse (HEK293, His)

4-1BBL/TNFSF9, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.