Activin RIB/ALK-4, Human (HEK293, His)

Name: Activin RIB/ALK-4, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0172870-01
Price: 101.5 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0172870-01

£101.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Activin RIB, also known as activin receptor type-1B (ACVR1B) or ALK-4, is a type I transmembrane serine/threonine kinase receptor that is part of the TGF-β receptor superfamily. Activin binds to a type II activin receptor (ACVR2or ACVR2B) and then recruits ACVR1B[1][2][3]. Activin RIB/ALK-4 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 103 amino acids (S24-E126) .
Molecular Formula
91 (Gene_ID) P36896 (S24-E126) (Accession)
Smiles
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVEHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0172870-01	10 µgQM-0172870-01 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0172870-02	50 µgQM-0172870-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Activin RIB/ALK-4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.