1 1

Activin RIB/ALK-4, Rhesus Macaque (HEK293, Fc)

Activin RIB/ALK-4, Rhesus Macaque (HEK293, Fc)

Size

QM-0202547-01

£52.94 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Activin RIB, also known as activin receptor type-1B (ACVR1B) or ALK-4, is a type I transmembrane serine/threonine kinase receptor that is part of the TGF-β receptor superfamily. Activin binds to a type II activin receptor (ACVR2or ACVR2B) and then recruits ACVR1B[1][2][3]. Activin RIB/ALK-4 Protein, Rhesus Macaque (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 100 amino acids (R27-E126) .

  • Molecular Formula

    696587 (Gene_ID) I2CYX8/NP_001252559.1 (R27-E126) (Accession)

  • Smiles

    RGIQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0202547-01
2 µgQM-0202547-01
£52.94/ea		 £0.00
£52.94/ea £0.00
10 µgQM-0202547-02
10 µgQM-0202547-02
£91.38/ea		 £0.00
£91.38/ea £0.00
50 µgQM-0202547-03
50 µgQM-0202547-03
£249.26/ea		 £0.00
£249.26/ea £0.00
100 µgQM-0202547-04
100 µgQM-0202547-04
£370.76/ea		 £0.00
£370.76/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Activin RIB/ALK-4, Rhesus Macaque (HEK293, Fc)

Activin RIB/ALK-4, Rhesus Macaque (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.