1 1

ACVR2A/Activin RIIA, Human/Cynomolgus (HEK293, Fc)

ACVR2A/Activin RIIA, Human/Cynomolgus (HEK293, Fc)

Size

QM-0205592-01

£52.94 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 134 amino acids (M1-P134) .

  • Molecular Formula

    92/102121129 (Gene_ID) P27037-1/G7PKJ4 (A20-P135) (Accession)

  • Smiles

    AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205592-01
2 µgQM-0205592-01
£52.94/ea		 £0.00
£52.94/ea £0.00
10 µgQM-0205592-02
10 µgQM-0205592-02
£97.00/ea		 £0.00
£97.00/ea £0.00
50 µgQM-0205592-03
50 µgQM-0205592-03
£243.19/ea		 £0.00
£243.19/ea £0.00
100 µgQM-0205592-04
100 µgQM-0205592-04
£359.82/ea		 £0.00
£359.82/ea £0.00
500 µgQM-0205592-05
500 µgQM-0205592-05
£979.48/ea		 £0.00
£979.48/ea £0.00
1 mgQM-0205592-06
1 mgQM-0205592-06
£1,433.88/ea		 £0.00
£1,433.88/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

ACVR2A/Activin RIIA, Human/Cynomolgus (HEK293, Fc)

ACVR2A/Activin RIIA, Human/Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.