Skip to product information
1 of 1

ACVR2A/Activin RIIA, Mouse (HEK293, His)

ACVR2A/Activin RIIA, Mouse (HEK293, His)

Size

SKU:QM-0205428-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 134 amino acids (M1-P134) .

  • Molecular Formula

    11480 (Gene_ID) P27038 (A20-P134) (Accession)

  • Smiles

    AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP

  • Purity

    95.8

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205428-01
5 µgQM-0205428-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0205428-02
10 µgQM-0205428-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0205428-03
50 µgQM-0205428-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0205428-04
100 µgQM-0205428-04
£404.78/ea
£0.00
£404.78/ea £0.00
500 µgQM-0205428-05
500 µgQM-0205428-05
£935.74/ea
£0.00
£935.74/ea £0.00
1 mgQM-0205428-06
1 mgQM-0205428-06
£1,377.99/ea
£0.00
£1,377.99/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ACVR2A/Activin RIIA, Mouse (HEK293, His)

ACVR2A/Activin RIIA, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.