Skip to product information
1 of 1

ACVR2B, Human/Cynomolgus (P. pastoris, N-His)

ACVR2B, Human/Cynomolgus (P. pastoris, N-His)

Size

SKU:QM-0168920

Price on request
Quantity

Request quote or documents

View full details
  • Description

    ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His) is the recombinant human-derived ACVR2B protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Molecular Formula

    93/102118668 (Gene_ID) Q13705-1 (S19-T137) /XP_045242398.1 (S40-T158) (Accession)

  • Smiles

    SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0168920
1 EachQM-0168920
£0.00/ea
£0.00
£0.00/ea £0.00

ACVR2B, Human/Cynomolgus (P. pastoris, N-His)

ACVR2B, Human/Cynomolgus (P. pastoris, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.