ACVR2B, Human/Cynomolgus (P. pastoris, N-His)
ACVR2B, Human/Cynomolgus (P. pastoris, N-His)
SKU:QM-0168920
Request quote or documents

Product Details
-
Description
ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His) is the recombinant human-derived ACVR2B protein, expressed by P. pastoris , with N-6*His labeled tag.
-
Molecular Formula
93/102118668 (Gene_ID) Q13705-1 (S19-T137) /XP_045242398.1 (S40-T158) (Accession)
-
Smiles
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
ACVR2B, Human/Cynomolgus (P. pastoris, N-His)
ACVR2B, Human/Cynomolgus (P. pastoris, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.