ACVR2B, Mouse (HEK293, His)

Name: ACVR2B, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0202407-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202407-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3[1]. ACVR2B Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 134 amino acids (M1-T134) .
Molecular Formula
11481 (Gene_ID) P27040-1 (S19-T134) (Accession)
Smiles
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPT
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202407-01	2 µgQM-0202407-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0202407-02	10 µgQM-0202407-02 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

50 µgQM-0202407-03	50 µgQM-0202407-03 £235.90/ea	£0.00	Quantity	£235.90/ea	£0.00

100 µgQM-0202407-04	100 µgQM-0202407-04 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ACVR2B, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.