1 1

ACYP1, Human (His)

ACYP1, Human (His)

Size

QM-0117355

Price on request

Request quote or documents

View full details

Product Details

  • Description

    ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.

  • Molecular Formula

    97 (Gene_ID) P07311 (M1-K99) (Accession)

  • Smiles

    HHHHHHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0117355
1 EachQM-0117355
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

ACYP1, Human (His)

ACYP1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.