Adenylate Kinase 1/AK1, Rat (His)
Adenylate Kinase 1/AK1, Rat (His)
SKU:QM-0205619-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
The adenylate kinase 1 (AK1) protein plays a crucial role in cellular energy homeostasis by maintaining the balance of adenylate nucleotides by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP.Adenylate Kinase 1/AK1 Protein, Rat (His) is the recombinant rat-derived Adenylate Kinase 1/AK1 protein, expressed by E.coli , with N-His labeled tag.
-
Molecular Formula
24183 (Gene_ID) P39069 (M1-K194) (Accession)
-
Smiles
MEDKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSIMEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVDTVFSQVCTYLDSLK
-
Purity
98
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice
Related Products
- QM-0048054-01 [1,4-BIs (diphenylphosphino) butane] (1,5-cyclooctadiene) rhodium (I) (tetrafluoroborate) [CAS 79255-71-3]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0009265 α-syn aggregation inhibitor-1
- QM-0007272 Zavondemstat (sodium) [CAS 2908753-07-9]
- QM-0006348-01 Xanthoanthrafil-d3 [CAS 1216710-83-6]
- QM-0006347-01 Xanthoanthrafil [CAS 1020251-53-9]
- QM-0002491-01 Ziritaxestat (Standard) [CAS 1628260-79-6]
Other industry favorites
- QM-0048054-01 [1,4-BIs (diphenylphosphino) butane] (1,5-cyclooctadiene) rhodium (I) (tetrafluoroborate) [CAS 79255-71-3]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0156055-01 YAP/TAZ inhibitor-3 [CAS 2506273-81-8]
- QM-0126644 [Leu8, D-Trp22, Tyr25] Somatostatin-28 [CAS 77909-99-0]
- QM-0126181 YAP/TAZ inhibitor-4
- QM-0112034-01 Zamicastat [CAS 1080028-80-3]
- QM-0152031-01 WRN inhibitor 5 [CAS 2923009-95-2]
- QM-0167342 [Lys4] Sarafotoxin S6c [CAS 1219444-22-0]
- QM-0166278 [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) [CAS 141055-85-8]
Adenylate Kinase 1/AK1, Rat (His)
Adenylate Kinase 1/AK1, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.