Adiponectin/Acrp30, Human (HEK293, His)

Name: Adiponectin/Acrp30, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202656-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202656-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].
Molecular Formula
9370 (Gene_ID) Q15848 (E19-N244) (Accession)
Smiles
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202656-01	2 µgQM-0202656-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0202656-02	10 µgQM-0202656-02 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

50 µgQM-0202656-03	50 µgQM-0202656-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0202656-04	100 µgQM-0202656-04 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Adiponectin/Acrp30, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.