Skip to product information
1 of 1

ADTRP, Human (Cell-Free, His, Myc)

ADTRP, Human (Cell-Free, His, Myc)

Size

SKU:QM-0101929

Price on request
Quantity

Request quote or documents

View full details
  • Description

    ADTRP protein exhibits specialized enzymatic activity, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for branched FAHFAs. This unique function distinguishes ADTRP, as it does not hydrolyze other major lipid classes. Moreover, ADTRP regulates endothelial cells, influencing TFPI expression and cell-associated anticoagulant activity, observed in in vitro settings. ADTRP Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived ADTRP protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag.

  • Molecular Formula

    84830 (Gene_ID) Q96IZ2 (M1-K230) (Accession)

  • Smiles

    MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0101929
1 EachQM-0101929
£0.00/ea
£0.00
£0.00/ea £0.00

ADTRP, Human (Cell-Free, His, Myc)

ADTRP, Human (Cell-Free, His, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.