ADTRP, Human (Cell-Free, His, Myc)
ADTRP, Human (Cell-Free, His, Myc)
SKU:QM-0101929
Request quote or documents

Product Details
-
Description
ADTRP protein exhibits specialized enzymatic activity, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for branched FAHFAs. This unique function distinguishes ADTRP, as it does not hydrolyze other major lipid classes. Moreover, ADTRP regulates endothelial cells, influencing TFPI expression and cell-associated anticoagulant activity, observed in in vitro settings. ADTRP Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived ADTRP protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag.
-
Molecular Formula
84830 (Gene_ID) Q96IZ2 (M1-K230) (Accession)
-
Smiles
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
ADTRP, Human (Cell-Free, His, Myc)
ADTRP, Human (Cell-Free, His, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.