Skip to product information
1 of 1

AGER, Human (HEK293, hFc)

AGER, Human (HEK293, hFc)

Size

SKU:QM-0204261-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. AGER Protein, Human (HEK293, hFc) is the recombinant human-derived AGER protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    177 (Gene_ID) Q15109 (Q24-A344) (Accession)

  • Smiles

    QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

  • Purity

    91.73

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204261-01
5 µgQM-0204261-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0204261-02
10 µgQM-0204261-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0204261-03
50 µgQM-0204261-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0204261-04
100 µgQM-0204261-04
£370.76/ea
£0.00
£370.76/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

AGER, Human (HEK293, hFc)

AGER, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.