Skip to product information
1 of 1

AGRP, Mouse (50a.a, HEK293, Fc)

AGRP, Mouse (50a.a, HEK293, Fc)

Size

SKU:QM-0204850-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The AGRP protein, encoded by the AGRP gene, regulates feeding behavior and body weight. It acts as a melanocortin receptor signaling antagonist, influencing appetite and metabolic balance. AGRP has multiple splice variants, adding to its regulatory complexity. Its expression extends beyond the central nervous system, with presence in tissues like the testis and placenta, indicating systemic involvement in physiological processes. AGRP Protein, Mouse (50a.a, HEK293, Fc) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    11604 (Gene_ID) P56473/NP_031453.1 (S82-T131) (Accession)

  • Smiles

    SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204850-01
2 µgQM-0204850-01
£58.12/ea
£0.00
£58.12/ea £0.00
5 µgQM-0204850-02
5 µgQM-0204850-02
£78.82/ea
£0.00
£78.82/ea £0.00
10 µgQM-0204850-03
10 µgQM-0204850-03
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0204850-04
50 µgQM-0204850-04
£316.08/ea
£0.00
£316.08/ea £0.00
100 µgQM-0204850-05
100 µgQM-0204850-05
£476.46/ea
£0.00
£476.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

AGRP, Mouse (50a.a, HEK293, Fc)

AGRP, Mouse (50a.a, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.