AHSG/Fetuin-A, Mouse (HEK293, His)

Name: AHSG/Fetuin-A, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0202862-01
Price: 61.22 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202862-01

£61.22 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
AHSG/Fetuin-A Protein, Mouse (HEK 293, His), a phosphorylated glycoprotein, it is synthesized mainly by the liver parenchyma cells.
Molecular Formula
11625 (Gene_ID) P29699 (A19-I345) (Accession)
Smiles
APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202862-01	5 µgQM-0202862-01 £61.22/ea	£0.00	Quantity	£61.22/ea	£0.00

10 µgQM-0202862-02	10 µgQM-0202862-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0202862-03	50 µgQM-0202862-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0202862-04	100 µgQM-0202862-04 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

AHSG/Fetuin-A, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.