AIF1, Human (C-His)

Name: AIF1, Human (C-His)
Brand: QuantiMol
SKU: QM-0193581-01
Price: 188.51 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0193581-01

£188.51 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
AIF1 Protein, Human (C-His), the recombinant human allograft inflammatory factor 1, has a His tag at the C-terminus. Allograft inflammatory factor-1 (AIF1) is an inflammatory cytokine produced mainly by macrophages within human white adipose tissue[1].
Molecular Formula
199 (Gene_ID) P55008 (S2-P147) (Accession)
Smiles
SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELPHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0193581-01	10 µgQM-0193581-01 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0193581-02	50 µgQM-0193581-02 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

AIF1, Human (C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.