AIF1, Human (N-His)

Name: AIF1, Human (N-His)
Brand: QuantiMol
SKU: QM-0204104-01
Price: 78.82 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204104-01

£78.82 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
199 (Gene_ID) P55008 (M1-P147) (Accession)
Smiles
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Purity
97.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204104-01	2 µgQM-0204104-01 £78.82/ea	£0.00	Quantity	£78.82/ea	£0.00

10 µgQM-0204104-02	10 µgQM-0204104-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0204104-03	50 µgQM-0204104-03 £591.89/ea	£0.00	Quantity	£591.89/ea	£0.00

100 µgQM-0204104-04	100 µgQM-0204104-04 £957.61/ea	£0.00	Quantity	£957.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

AIF1, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.