1 1

AIF1, Mouse (His)

AIF1, Mouse (His)

Size

QM-0135212

£465.53 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.

  • Molecular Formula

    11629 (Gene_ID) O70200 (S2-P147) (Accession)

  • Smiles

    SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

  • Purity

    93

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
50 µgQM-0135212
50 µgQM-0135212
£465.53/ea		 £0.00
£465.53/ea £0.00

Related Products

Other industry favorites

AIF1, Mouse (His)

AIF1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.