Skip to product information
1 of 1

AITRL/TNFSF18 Trimer, Human (HEK293, His-Flag)

AITRL/TNFSF18 Trimer, Human (HEK293, His-Flag)

Size

SKU:QM-0176826-01

£193.37 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR) . When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC) -activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1) [2]. AITRL/TNFSF18 Trimer Protein, Human (HEK293, His-Flag) is a recombinant human AITRL (Q72-S199) trimer with N-terminal His and Flag tag, which is expressed in HEK293.

  • Molecular Formula

    8995 (Gene_ID) Q9UNG2 (Q50-S177) (Accession)

  • Smiles

    QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0176826-01
20 µgQM-0176826-01
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0176826-02
50 µgQM-0176826-02
£327.02/ea
£0.00
£327.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

AITRL/TNFSF18 Trimer, Human (HEK293, His-Flag)

AITRL/TNFSF18 Trimer, Human (HEK293, His-Flag) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.