AKR1C2, Human

Name: AKR1C2, Human
Brand: QuantiMol
SKU: QM-0193643-01
Price: 263.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0193643-01

£263.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
AKR1C2 Protein, Human is a recombinant human AKR1C2. AKR1C2 is a member of the aldo/keto reductase superfamily and has critical roles in the tumorigenesis and progression of malignant tumours[1].
Molecular Formula
1646 (Gene_ID) P52895 (M1-Y323) (Accession)
Smiles
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Purity
96.48
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0193643-01	10 µgQM-0193643-01 £263.32/ea	£0.00	Quantity	£263.32/ea	£0.00

50 µgQM-0193643-02	50 µgQM-0193643-02 £605.96/ea	£0.00	Quantity	£605.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

AKR1C2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.