Name: ALK-1, Canine (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205578-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ALK-1 Protein, Canine (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 119 amino acids (M1-K119) .
Molecular Formula
/ (Gene_ID) E2R174 (G22-K119) (Accession)
Smiles
GNPVKPSRGPLLTCTCESPHCRGPTCQGTWCTVVLVREEGRHPQEHRGCGNLNEELCRGRPTEFVNHYCCYSPLCNHNVSLVLEATQIPPEQPKVDGQ
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205578-01	2 µgQM-0205578-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205578-02	10 µgQM-0205578-02 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

50 µgQM-0205578-03	50 µgQM-0205578-03 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

100 µgQM-0205578-04	100 µgQM-0205578-04 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

500 µgQM-0205578-05	500 µgQM-0205578-05 £857.98/ea	£0.00	Quantity	£857.98/ea	£0.00

1 mgQM-0205578-06	1 mgQM-0205578-06 £1,422.95/ea	£0.00	Quantity	£1,422.95/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ALK-1, Canine (HEK293, Fc)

ALK-1, Canine (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.