Skip to product information
1 of 1

ALK-1, Human (HEK293, His)

ALK-1, Human (HEK293, His)

Size

SKU:QM-0129607

Price on request
Quantity

Request quote or documents

View full details
  • Description

    ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ALK-1 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 118 amino acids (M1-Q118) .

  • Molecular Formula

    94 (Gene_ID) P37023 (D22-Q118) (Accession)

  • Smiles

    MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0129607
1 EachQM-0129607
£0.00/ea
£0.00
£0.00/ea £0.00

ALK-1, Human (HEK293, His)

ALK-1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.