ALK-7, Cynomolgus (HEK293, His)

Name: ALK-7, Cynomolgus (HEK293, His)
Brand: QuantiMol
SKU: QM-0026196-01
Price: 320.94 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0026196-01

£320.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
ALK-7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ALK-7 protein, expressed by HEK293, with C-His tag.
Molecular Formula
102131774 (Gene_ID) A0A2K5VZP2 (G25-E113) (Accession)
Smiles
GLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0026196-01	20 µgQM-0026196-01 £320.94/ea	£0.00	Quantity	£320.94/ea	£0.00

50 µgQM-0026196-02	50 µgQM-0026196-02 £542.08/ea	£0.00	Quantity	£542.08/ea	£0.00

100 µgQM-0026196-03	100 µgQM-0026196-03 £847.04/ea	£0.00	Quantity	£847.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ALK-7, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.