1 1

ALK-7, Human (Biotinylated, HEK293, His, Avi)

ALK-7, Human (Biotinylated, HEK293, His, Avi)

Size

QM-0026209

Price on request

Request quote or documents

View full details

Product Details

  • Description

    ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.

  • Molecular Formula

    130399 (Gene_ID) Q8NER5 (L22-E113) (Accession)

  • Smiles

    LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0026209
1 EachQM-0026209
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

ALK-7, Human (Biotinylated, HEK293, His, Avi)

ALK-7, Human (Biotinylated, HEK293, His, Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.