Skip to product information
1 of 1

Allergin-1, Human (HEK293, His)

Allergin-1, Human (HEK293, His)

Size

SKU:QM-0203355-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

  • Smiles

    RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203355-01
5 µgQM-0203355-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0203355-02
10 µgQM-0203355-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0203355-03
50 µgQM-0203355-03
£282.06/ea
£0.00
£282.06/ea £0.00
100 µgQM-0203355-04
100 µgQM-0203355-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Allergin-1, Human (HEK293, His)

Allergin-1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.