1 1

Amphiregulin, Human

Amphiregulin, Human

Size

QM-0205795-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Amphiregulin Protein, an EGFR ligand, serves as an autocrine growth factor and mitogen for various cells, including astrocytes, Schwann cells, and fibroblasts. It promotes cellular proliferation and interacts with CNIH in its immature precursor stage. Amphiregulin's EGFR activation underscores its role in essential cellular processes, emphasizing its significance as a regulator of cell growth and function in diverse cell types. Amphiregulin Protein, Human is the recombinant human-derived Amphiregulin protein, expressed by E. coli , with tag free.

  • Molecular Formula

    374 (Gene_ID) P15514 (S101-K198) (Accession)

  • Smiles

    SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

  • Purity

    97.88

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205795-01
2 µgQM-0205795-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0205795-02
10 µgQM-0205795-02
£97.00/ea		 £0.00
£97.00/ea £0.00
50 µgQM-0205795-03
50 µgQM-0205795-03
£249.26/ea		 £0.00
£249.26/ea £0.00
100 µgQM-0205795-04
100 µgQM-0205795-04
£409.64/ea		 £0.00
£409.64/ea £0.00
250 µgQM-0205795-05
250 µgQM-0205795-05
£769.28/ea		 £0.00
£769.28/ea £0.00
500 µgQM-0205795-06
500 µgQM-0205795-06
£1,377.99/ea		 £0.00
£1,377.99/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Amphiregulin, Human

Amphiregulin, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.