Skip to product information
1 of 1

Amphiregulin, Human (HEK293)

Amphiregulin, Human (HEK293)

Size

SKU:QM-0205946-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Amphiregulin Protein, Human (HEK293) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

  • Molecular Formula

    374 (Gene_ID) P15514 (S101-K198) (Accession)

  • Smiles

    SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205946-01
2 µgQM-0205946-01
£58.12/ea
£0.00
£58.12/ea £0.00
5 µgQM-0205946-02
5 µgQM-0205946-02
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0205946-03
10 µgQM-0205946-03
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0205946-04
50 µgQM-0205946-04
£260.19/ea
£0.00
£260.19/ea £0.00
100 µgQM-0205946-05
100 µgQM-0205946-05
£415.71/ea
£0.00
£415.71/ea £0.00
250 µgQM-0205946-06
250 µgQM-0205946-06
£847.04/ea
£0.00
£847.04/ea £0.00
500 µgQM-0205946-07
500 µgQM-0205946-07
£1,433.88/ea
£0.00
£1,433.88/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Amphiregulin, Human (HEK293)

Amphiregulin, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.