Skip to product information
1 of 1

β-Amyloid (42-1), human (TFA)

β-Amyloid (42-1), human (TFA)

Size

SKU:QM-0123403

Price on request
Quantity

Request quote or documents

View full details
  • Description

    β-Amyloid (42-1), human TFA is the inactive form of Amyloid β Peptide (1-42) . β-Amyloid (42-1), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].

  • Smiles

    [AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD(TFAsalt)]

  • Target

    Amyloid-β

  • Storage Conditions

    -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

  • Shipping Conditions

    Blue Ice

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0123403
1 EachQM-0123403
£0.00/ea
£0.00
£0.00/ea £0.00

β-Amyloid (42-1), human (TFA)

β-Amyloid (42-1), human (TFA) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.