Skip to product information
1 of 1

Androgen receptor, Human (His-SUMO, Myc)

Androgen receptor, Human (His-SUMO, Myc)

Size

SKU:QM-0027575-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

  • Molecular Formula

    367 (Gene_ID) P10275-1 (D551-T919) (Accession)

  • Smiles

    DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0027575-01
5 µgQM-0027575-01
£127.38/ea
£0.00
£127.38/ea £0.00
10 µgQM-0027575-02
10 µgQM-0027575-02
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0027575-03
50 µgQM-0027575-03
£492.26/ea
£0.00
£492.26/ea £0.00
100 µgQM-0027575-04
100 µgQM-0027575-04
£758.35/ea
£0.00
£758.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Androgen receptor, Human (His-SUMO, Myc)

Androgen receptor, Human (His-SUMO, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.