Angiopoietin-2, Mouse (HEK293, His)

Name: Angiopoietin-2, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0106632
Price: 437.58 GBP
Availability: InStock

Size 50 µg

SKU:QM-0106632

£437.58 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
11601 (Gene_ID) O35608 (K275-F496) (Accession)
Smiles
KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity
96.1
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
50 µgQM-0106632	50 µgQM-0106632 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Angiopoietin-2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.