Skip to product information
1 of 1

ANGPT2/Angiopoietin-2, Dog (HEK293, His)

ANGPT2/Angiopoietin-2, Dog (HEK293, His)

Size

SKU:QM-0201600-01

£327.02 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ANGPT2/Angiopoietin-2 (dog) complexly regulates angiogenesis by binding to TEK/TIE2, competitively affecting ANGPT1 signaling. It independently induces TEK/TIE2 phosphorylation and, in the absence of VEGF, may cause endothelial cell apoptosis, thereby promoting vascular regression. ANGPT2/Angiopoietin-2 Protein, Dog (HEK293, His) is the recombinant dog-derived ANGPT2/Angiopoietin-2, Dog, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    607616 (Gene_ID) A0A8J8 (Y19-F495) (Accession)

  • Smiles

    YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0201600-01
20 µgQM-0201600-01
£327.02/ea
£0.00
£327.02/ea £0.00
50 µgQM-0201600-02
50 µgQM-0201600-02
£565.16/ea
£0.00
£565.16/ea £0.00
100 µgQM-0201600-03
100 µgQM-0201600-03
£879.85/ea
£0.00
£879.85/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ANGPT2/Angiopoietin-2, Dog (HEK293, His)

ANGPT2/Angiopoietin-2, Dog (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.