ANGPTL2/Angiopoietin-like 2, Human (HEK293, His)

ANGPTL2/angiopoietin-like 2 protein takes center stage as it induces endothelial cell sprouting through dual autocrine and paracrine mechanisms. This ability underscores its critical role in angiogenesis, where balanced signaling events control the formation of new blood vessels. ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) is the recombinant human-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with N-His labeled tag.

23452 (Gene_ID) Q9UKU9-1 (D245-H493) (Accession)

DQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

98

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.