1 1

ANGPTL4/Angiopoietin-related 4, Human (GST)

ANGPTL4/Angiopoietin-related 4, Human (GST)

Size

QM-0098739-01

£238.32 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    51129 (Gene_ID) Q9BY76-1 (V28-E403) (Accession)

  • Smiles

    VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0098739-01
20 µgQM-0098739-01
£238.32/ea		 £0.00
£238.32/ea £0.00
50 µgQM-0098739-02
50 µgQM-0098739-02
£404.78/ea		 £0.00
£404.78/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

ANGPTL4/Angiopoietin-related 4, Human (GST)

ANGPTL4/Angiopoietin-related 4, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.