1 1

ANGPTL4/Angiopoietin-related 4, Mouse (HEK293, Fc, solution)

ANGPTL4/Angiopoietin-related 4, Mouse (HEK293, Fc, solution)

Size

QM-0179180-01

£158.00 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Angiopoietin-related protein 4/ANGPTL4 Protein, Mouse (HEK293, Fc) expresses in HEK293 with an Fc fragment at the C-terminus. Angiopoietin-Related Protein 4 (ANGPTL4) is a multifunctional cytokine regulating vascular permeability, angiogenesis, and inflammation[1].

  • Molecular Formula

    57875 (Gene_ID) Q9Z1P8 (K167-S410) (Accession)

  • Smiles

    KRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0179180-01
10 µgQM-0179180-01
£158.00/ea		 £0.00
£158.00/ea £0.00
50 µgQM-0179180-02
50 µgQM-0179180-02
£406.69/ea		 £0.00
£406.69/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

ANGPTL4/Angiopoietin-related 4, Mouse (HEK293, Fc, solution)

ANGPTL4/Angiopoietin-related 4, Mouse (HEK293, Fc, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.