Skip to product information
1 of 1

ANGPTL7/Angiopoietin-related 7, Human (HEK293, His)

ANGPTL7/Angiopoietin-related 7, Human (HEK293, His)

Size

SKU:QM-0183475-01

£188.51 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His) regulates angiogenesis, and promotes the expansion and repopulation of human hematopoietic stem cells and progenitor cells through the Wnt signaling pathway. Angiopoietin-related Protein 7 is a pro-inflammatory effector that induces inflammatory responses in macrophages through the P38 MAPK signaling pathway.

  • Molecular Formula

    10218 (Gene_ID) O43827 (Q27-P346) (Accession)

  • Smiles

    QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPHHHHHHHHHH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0183475-01
10 µgQM-0183475-01
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0183475-02
50 µgQM-0183475-02
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ANGPTL7/Angiopoietin-related 7, Human (HEK293, His)

ANGPTL7/Angiopoietin-related 7, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.