Skip to product information
1 of 1

Animal-Free 4-1BBL/TNFSF9, Human (His)

Animal-Free 4-1BBL/TNFSF9, Human (His)

Size

SKU:QM-0199696-01

£106.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. Animal-Free 4-1BBL/TNFSF9 Protein, Human (His) is the recombinant human-derived animal-Free4-1BBL/TNFSF9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    8744 (Gene_ID) P41273 (M70-E254) (Accession)

  • Smiles

    MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199696-01
2 µgQM-0199696-01
£106.00/ea
£0.00
£106.00/ea £0.00
10 µgQM-0199696-02
10 µgQM-0199696-02
£294.22/ea
£0.00
£294.22/ea £0.00
50 µgQM-0199696-03
50 µgQM-0199696-03
£736.48/ea
£0.00
£736.48/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free 4-1BBL/TNFSF9, Human (His)

Animal-Free 4-1BBL/TNFSF9, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.