Animal-Free 4-1BBL/TNFSF9, Mouse (His)

Name: Animal-Free 4-1BBL/TNFSF9, Mouse (His)
Brand: QuantiMol
SKU: QM-0198391-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0198391-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
4-1BBL/TNFSF9 Protein, a cytokine, binds TNFRSF9, inducing proliferation in activated peripheral blood T-cells.It's implicated in activation-induced cell death (AICD) and contributes to cognate interactions between T-cells and B-cells/macrophages.Functioning as a homotrimer enhances its biological activity.Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His) is the recombinant mouse-derived animal-Free4-1BBL/TNFSF9 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.
Molecular Formula
21950 (Gene_ID) P41274 (R104-T211) (Accession)
Smiles
MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFT
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0198391-01	2 µgQM-0198391-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0198391-02	10 µgQM-0198391-02 £210.38/ea	£0.00	Quantity	£210.38/ea	£0.00

50 µgQM-0198391-03	50 µgQM-0198391-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free 4-1BBL/TNFSF9, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.