Skip to product information
1 of 1

Animal-Free APRIL/TNFSF13, Human (His)

Animal-Free APRIL/TNFSF13, Human (His)

Size

SKU:QM-0176386-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. Animal-Free APRIL/TNFSF13 Protein, Human (His) is produced by E. coli (A105-L250) with C-terminal His-tag.This product is for cell culture use only.

  • Molecular Formula

    8741 (Gene_ID) O75888 (A105-L250) (Accession)

  • Smiles

    MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0176386-01
2 µgQM-0176386-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0176386-02
10 µgQM-0176386-02
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0176386-03
50 µgQM-0176386-03
£420.57/ea
£0.00
£420.57/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free APRIL/TNFSF13, Human (His)

Animal-Free APRIL/TNFSF13, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.