1 1

Animal-Free BMP-10, Human (His)

Animal-Free BMP-10, Human (His)

Size

QM-0173862-01

£120.63 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    27302 (Gene_ID) O95393 (N317-R424) (Accession)

  • Smiles

    MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0173862-01
2 µgQM-0173862-01
£120.63/ea		 £0.00
£120.63/ea £0.00
10 µgQM-0173862-02
10 µgQM-0173862-02
£337.95/ea		 £0.00
£337.95/ea £0.00
50 µgQM-0173862-03
50 µgQM-0173862-03
£855.54/ea		 £0.00
£855.54/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Animal-Free BMP-10, Human (His)

Animal-Free BMP-10, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.