Skip to product information
1 of 1

Animal-Free BMP-12/GDF-7, Human (His)

Animal-Free BMP-12/GDF-7, Human (His)

Size

SKU:QM-0180924-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BMP-12/GDF-7 Protein, existing as a homodimer with disulfide linkages, is hypothesized to influence the motor area of the primate neocortex. Its distinct structural characteristics suggest a unique mode of action, possibly contributing to cellular events integral to motor area function. The precise details of BMP-12/GDF-7 Protein's role in this neural context and its implications in motor-related processes await further research. Animal-Free BMP-12/GDF-7 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-12/GDF-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    151449 (Gene_ID) Q7Z4P5 (T322-R450) (Accession)

  • Smiles

    MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0180924-01
2 µgQM-0180924-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0180924-02
10 µgQM-0180924-02
£135.25/ea
£0.00
£135.25/ea £0.00
50 µgQM-0180924-03
50 µgQM-0180924-03
£384.13/ea
£0.00
£384.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free BMP-12/GDF-7, Human (His)

Animal-Free BMP-12/GDF-7, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.