Skip to product information
1 of 1

Animal-Free BMP-3, Human (His)

Animal-Free BMP-3, Human (His)

Size

SKU:QM-0197089-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. Animal-Free BMP-3 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-3 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    651 (Gene_ID) P12645 (Q363-R472) (Accession)

  • Smiles

    MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0197089-01
2 µgQM-0197089-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0197089-02
10 µgQM-0197089-02
£124.00/ea
£0.00
£124.00/ea £0.00
50 µgQM-0197089-03
50 µgQM-0197089-03
£348.89/ea
£0.00
£348.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free BMP-3, Human (His)

Animal-Free BMP-3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.