Animal-Free BMP-6, Human (His)

Name: Animal-Free BMP-6, Human (His)
Brand: QuantiMol
SKU: QM-0195435-01
Price: 134.13 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0195435-01

£134.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Molecular Formula
654 (Gene_ID) P22004 (V397-H513) (Accession)
Smiles
MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0195435-01	2 µgQM-0195435-01 £134.13/ea	£0.00	Quantity	£134.13/ea	£0.00

10 µgQM-0195435-02	10 µgQM-0195435-02 £379.26/ea	£0.00	Quantity	£379.26/ea	£0.00

50 µgQM-0195435-03	50 µgQM-0195435-03 £974.62/ea	£0.00	Quantity	£974.62/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free BMP-6, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.