Skip to product information
1 of 1

Animal-Free BMP-8a, Human (His)

Animal-Free BMP-8a, Human (His)

Size

SKU:QM-0199004-01

£110.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BMP-8 is a pleiotropic ligand protein act as a reproductive system regulator, enriched in the ovary. BMP-8 is encoded by a pair of genes BMP8A and BMP8B, belonging to TNF-β family[1]. BMP-8A activates the SMAD1/5/8 and the SMAD2/3 pathways in granulosa cells, to inhibit gonadotropin-induced progesterone production and steroidogenesis-related gene expression[1]. BMP-8A also involves in Nrf2 phosphorylation in cancer cells to promote survival and drug resistance[2]. BMP-8a Protein, Human is 402 a.a. with 2 glycosylation domains. Animal-Free BMP-8a Protein, Human (His) is a animal free recombinant human protein produced in E. coli cells, with 139 a.a. (A264-H402) and C-terminal His-tag.This product is for cell culture use only.

  • Molecular Formula

    353500 (Gene_ID) AAP74559.1 (A264-H402) (Accession)

  • Smiles

    MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199004-01
2 µgQM-0199004-01
£110.50/ea
£0.00
£110.50/ea £0.00
10 µgQM-0199004-02
10 µgQM-0199004-02
£306.37/ea
£0.00
£306.37/ea £0.00
50 µgQM-0199004-03
50 µgQM-0199004-03
£769.28/ea
£0.00
£769.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free BMP-8a, Human (His)

Animal-Free BMP-8a, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.