Skip to product information
1 of 1

Animal-Free CNTF, Human (His)

Animal-Free CNTF, Human (His)

Size

SKU:QM-0196613-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. Animal-Free CNTF Protein, Human (His) is produced by E. coli (M1-M200) with C-terminal His-tag.This product is for cell culture use only.

  • Molecular Formula

    1270 (Gene_ID) P26441 (M1-M200) (Accession)

  • Smiles

    MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0196613-01
2 µgQM-0196613-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0196613-02
10 µgQM-0196613-02
£221.31/ea
£0.00
£221.31/ea £0.00
50 µgQM-0196613-03
50 µgQM-0196613-03
£526.28/ea
£0.00
£526.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free CNTF, Human (His)

Animal-Free CNTF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.