Animal-Free EGF, Human (His)

Name: Animal-Free EGF, Human (His)
Brand: QuantiMol
SKU: QM-0203077-01
Price: 51.91 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203077-01

£51.91 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
EGF protein does not possess the conserved residue (s) necessary for propagating feature annotation. Animal-Free EGF Protein, Human (His) is the recombinant human-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Molecular Formula
1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)
Smiles
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203077-01	2 µgQM-0203077-01 £51.91/ea	£0.00	Quantity	£51.91/ea	£0.00

10 µgQM-0203077-02	10 µgQM-0203077-02 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

50 µgQM-0203077-03	50 µgQM-0203077-03 £100.38/ea	£0.00	Quantity	£100.38/ea	£0.00

100 µgQM-0203077-04	100 µgQM-0203077-04 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free EGF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.