Skip to product information
1 of 1

Animal-Free EGF, Mouse (His)

Animal-Free EGF, Mouse (His)

Size

SKU:QM-0169215-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    13645 (Gene_ID) P01132 (N977-R1029) (Accession)

  • Smiles

    MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0169215-01
2 µgQM-0169215-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0169215-02
10 µgQM-0169215-02
£64.33/ea
£0.00
£64.33/ea £0.00
50 µgQM-0169215-03
50 µgQM-0169215-03
£137.50/ea
£0.00
£137.50/ea £0.00
100 µgQM-0169215-04
100 µgQM-0169215-04
£243.19/ea
£0.00
£243.19/ea £0.00
500 µgQM-0169215-05
500 µgQM-0169215-05
£580.96/ea
£0.00
£580.96/ea £0.00
1 mgQM-0169215-06
1 mgQM-0169215-06
£913.87/ea
£0.00
£913.87/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free EGF, Mouse (His)

Animal-Free EGF, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.