Skip to product information
1 of 1

Animal-Free ENA-78/CXCL5, Human (His)

Animal-Free ENA-78/CXCL5, Human (His)

Size

SKU:QM-0199076-01

£91.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CXCL5 protein is critical in neutrophil activation and displays enhanced chemotactic activity on neutrophils, with increased potency of ENA-78 (8-78) and ENA-78 (9-78) isoforms three times. Structurally, CXCL5 exists as monomers and homodimers, emphasizing its multifunctional molecular configuration. Animal-Free ENA-78/CXCL5 Protein, Human (His) is the recombinant human-derived animal-FreeENA-78/CXCL5 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    6374 (Gene_ID) P42830 (R45-N114) (Accession)

  • Smiles

    RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199076-01
2 µgQM-0199076-01
£91.38/ea
£0.00
£91.38/ea £0.00
10 µgQM-0199076-02
10 µgQM-0199076-02
£249.26/ea
£0.00
£249.26/ea £0.00
50 µgQM-0199076-03
50 µgQM-0199076-03
£481.32/ea
£0.00
£481.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free ENA-78/CXCL5, Human (His)

Animal-Free ENA-78/CXCL5, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.